Robert L. Fine - Tenafly NJ, US Paul Brandt-Rauf - Scarsdale NY, US Yueha Mao - New York NY, US
Assignee:
The Trustees of Columbia University in the City of New York - New York NY
International Classification:
C07K 5/00 C07K 14/00 A61K 39/295
US Classification:
530350, 4241841
Abstract:
Disclosed are polypeptides comprising a first segment of continuous amino acids having the sequence AQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPDSD (SEQ ID NO. 1) covalently linked to a second segment of continuous amino acids having the sequence DSDPGETKFMLKKHRSTSQGKKSKLHSSHARSGGPEKGAQA (SEQ ID NO. 2), or at least two of each covalently linked to each ether. The polypeptides are shown to induce apoptosis of cancer cells that contain mutant p53 or over-expressed wild-type p53.
Real Estate Brokers
Robert Fine, Staten Island NY Licensed Real Estate Salesperson
Coldwell Banker Di Tommaso Realty, 113 New Dorp Plaza N, Staten Island, NY 10306 718 667-8000 (Office), 646 872-7700 (Cell), 718 667-8272 (Fax)
Experience:
8 years
Description:
I am a full time professional Realtor, associated with Coldwell Banker Di Tommaso Realty of Staten Island, NY; licensed by the State of New York as a Real Estate Salesperson I am a Realtor member of the National Association of Realtors with a number of designations: CNE: Certified Negotiation Expert, e-Pro, GREEN, SFR: Short Sale and Foreclosure, and At Home with Diversity designation. Coldwell Banker Di Tommaso Realty has been an active force in the Staten Island real estate industry for many years. We are located on New Dorp Plaza in the heart of New Dorp. To demonstrate our faith in the future of Staten Island we have built a brand new 4000 square foot office, with the latest technology. Please call me or just drop by to visit. I am using my many years of leading edge technical expertise, gained while working in the Financial Industry, in my current real estate practice representing both Buyers and Sellers. I utilize a Text Message system for my Sellers, and also automated Feedback systems and appointment scheduling. Now is Great Time to Purchase or Sell a Home. The choices are excellent and the interest rate is historically low. Its time to make that first purchase of a home, or to trade up from your present house. Call 718-667-8000 and ask for Bob Fine. Call me directly at my cell at 646-872-7700. My web address is //statenisland.listingbook.com And My direct e-mail is [email protected]
REO / Bank Owned Short sales Residential sales Luxury homes First time home buyers Distressed properties
Work:
Coldwell Banker Di Tommaso Realty. Staten Island, NY 718 677-8000 (Phone) License #647596534
Certifications:
SRES GRI SFR e-PRO
Client type:
Home Buyers Home Sellers
Property type:
Single Family Home Condo/Townhome Multi-family
Interests:
Helping my clients and customers achieve their Real Estate goals in an efficient manner.
About:
I am a Staten Island, NY full time REALTOR. I specialize in helping Buyers and Sellers fulfill their dreams and accomplish their goals in an efficient manner. I am associated with an real estate firm that is celebrating its 25th anniversary being a major Coldwell Banker office. Our technology is leading edge, while our values of hard work for our clients remain old fashioned. Call me and lets make an appointment to discuss your needs and wants for Selling and Buying. Please come on over to our new office building at 113 New Dorp Plaza. My office number is 718-667-8000 x 119. Call my cell directly at 646-872-7700. email to: [email protected]
License Records
Robert Fine
License #:
MT002180T - Expired
Category:
Medicine
Type:
Graduate Medical Trainee
Robert H Fine
License #:
NS091947A - Expired
Category:
Real Estate Commission
Type:
Real Estate Salesperson-Standard
Name / Title
Company / Classification
Phones & Addresses
Robert Fine Partner
Kennedy Ziner & Llp Lehan Certified Public Accountants
2300 Crown Colony Dr, Quincy, MA 02169 617 472-0700
Robert Fine Director
Lightdale, Charles M.D Medical Doctor's Office
630 W 168 St, New York, NY 10032
Robert L. Fine Hematology
The New York and Presbyterian Hospital Medical Doctor's Office · General Hospital · Health/Allied Services
161 Ft Washington Ave, New York, NY 10032 212 305-1020, 212 305-5166, 212 305-1860
MasterCard since Jun 2006
VP Finance & Strategic Planning
MasterCard Jul 2004 - Jun 2006
Director, Corporate Planning and Financial Analysis
Interpublic Group Jun 2002 - Jun 2004
Interpublic Sports & Entertainment Group Controller
Cappelli Enterprises Jun 2000 - Apr 2002
Controller/Financial Analyst
Ernst & Young Apr 1999 - Jun 2000
Senior Associate
Education:
Northeastern University 1995 - 1996
MS Accounting/MBA, Accounting/Finance
University of Rochester 1988 - 1992
Outside Sales For Southeastern Co, Eastern Nm, & Western Ks At Rust Automation & Controls, Inc.
Fine Family Dental - Englewood New Jersey since Oct 2012
Consultant
Dana Imports Jan 2008 - Oct 2009
Consultant
Passaic Board of Education Mar 2005 - Jan 2008
Teacher
The B. Manischewitz Company - Jersey City NJ Mar 1983 - Jun 2004
Director of Materials Management
Education:
Rutgers, The State University of New Jersey-Newark 1972 - 1976
MBA, Management
Rutgers, The State University of New Jersey-Newark 1968 - 1972
BA, Economics
161 Fort Washington Ave Suite 6-435, New York, NY 10032 212 305-1168 (Phone), 212 305-7348 (Fax)
650 W 168Th St Suite 2004, New York, NY 10032 212 305-1168 (Phone), 212 305-7348 (Fax)
NEW YORK PRESBYTERIAN MEDICAL CENTER 650 W 168Th St Suite 20-04, New York, NY 10032 212 305-1168 (Phone), 212 305-7348 (Fax)
COLUMBIA PRESBY MED 161 Fort Washington Ave, New York, NY 10032 212 305-1731 (Phone), 212 305-6762 (Fax)
Certifications:
Internal Medicine, 1983 Medical Oncology, 1985
Awards:
Healthgrades Honor Roll
Languages:
English
Education:
Medical School U Of Chgo Div Of Bio Sci Pritzker Sch Of Med Graduated: 1979 Medical School Clinical Center At The Nih Graduated: 1979 Medical School Stanford University Hospital Graduated: 1979
New York Presbyterian Hospital Hematology Oncology Clinic 177 Ft Washington Ave, New York, NY 10032 212 305-8610 (phone), 212 305-3035 (fax)
Columbia University Medical Center Hematology/oncology 161 Ft Washington Ave Herbert Irving Pav Hip, New York, NY 10032 212 305-5098 (phone), 212 305-6762 (fax)
Education:
Medical School University of Chicago Pritzker School of Medicine Graduated: 1979
Procedures:
Chemotherapy
Conditions:
Liver Cancer Lung Cancer Pancreatic Cancer Acute Bronchitis Acute Renal Failure
Languages:
English Spanish
Description:
Dr. Fine graduated from the University of Chicago Pritzker School of Medicine in 1979. He works in New York, NY and 1 other location and specializes in Hematology/Oncology. Dr. Fine is affiliated with New York Presbyterian Hospital Columbia University Medical Center and New York Presbyterian Westchester Division.
HealthTexas Provider NetworkSupportive & Palliative Care Clinic At Baylor University Medical Center At Dallas 3600 Gaston Ave STE 605, Dallas, TX 75246 214 820-9248 (phone), 214 820-9258 (fax)
Education:
Medical School University of Texas Southwestern Medical Center at Dallas Graduated: 1978
Procedures:
Electrocardiogram (EKG or ECG) Vaccine Administration
Dr. Fine graduated from the University of Texas Southwestern Medical Center at Dallas in 1978. He works in Dallas, TX and specializes in Hospice & Palliative Medicine. Dr. Fine is affiliated with Baylor Scott & White Medical Center Waxahachie and Baylor University Medical Center.
St. Cyril - St. Clara School Chicago IL 1953-1955, John P. Altgeld Elementary School Chicago IL 1957-1958, Van Vlissingen Elementary School Chicago IL 1958-1959
Community:
William Bill, Darryl Simpson, Gerald Braasch, Gerry Armin
Biography:
Life
The last school I attended was Fenger high, however I was still going by the l...